PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032065m
Common NameCICLE_v10032065mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 333aa    MW: 36571.5 Da    PI: 8.9034
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032065mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.5e-2586130145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Ciclev10032065m  86 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 130
                      79****************************************986 PP

2QLQ63.94.1e-222460137
              QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     s+FT +Q+q+L++Q+l++Ky++a++PvPp+L+++iqk
  Ciclev10032065m 24 SPFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQK 60
                     89*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.1E-122460IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.3952560IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-162559IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.76286130IPR014977WRC domain
PfamPF088793.8E-2187129IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MNSGNGGGGA GGAGGLGMMG MRASPFTVSQ WQELEHQALI FKYMVAGLPV PPDLVLPIQK  60
SFESISHRFF HHPTMGYCSF YGKKVDPEPG RCRRTDGKKW RCSKDAYPDS KYCERHMHRG  120
RNRSRKPVES QTITQSSSTV TSLTATGSSG GTGSYQNLPL HAFANPQGTT SGTNQSHYHV  180
DSISCGIPNK EYRYLQVQGL KPEVGEHSFF TEASGSNRGL QMDSPIDSAW PLMQSRVSSH  240
PQSKSSNTSI LQNDYPQHSL FSSEFTSGEP VKQEGQSLRP FFDEWPKTRD SWSGLEDKRS  300
HQTSFSTTKL SISIPMASSD FSATSSRSPH DN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437422.10.0hypothetical protein CICLE_v10032065mg
RefseqXP_006484683.10.0PREDICTED: growth-regulating factor 4-like
RefseqXP_006484684.10.0PREDICTED: growth-regulating factor 4-like
SwissprotQ6AWY65e-93GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLV4TBP50.0V4TBP5_9R
STRINGVIT_16s0039g01450.t011e-179(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143391019
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-46growth-regulating factor 5